PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10017012m
Common NameEUTSA_v10017012mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GATA
Protein Properties Length: 296aa    MW: 32707.6 Da    PI: 9.8152
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10017012mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.82e-20214248135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  Thhalv10017012m 214 CTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRL 248
                      *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.7E-20208258IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-15212245IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.28E-15212271No hitNo description
PROSITE profilePS5011412.123212244IPR000679Zinc finger, GATA-type
CDDcd002021.49E-17213262No hitNo description
PfamPF003204.2E-18214248IPR000679Zinc finger, GATA-type
PROSITE patternPS003440214239IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MNNGSWLPEE DFKGLGDNFF DDLINHLDFP LEDIETGSGD GDWDAEFQNL VPPSLDVLTS  60
LSSEFTHGST CKGQRVGVQK PVPVLKQSSS SEVDSSLPDV KVSKLFQSSS PVSVLESANG  120
SVSFQNPNRA QRLALPVKGI RSKRKRPTEP RIRSLLTFAS GMSQQFAPDE SESETYLSSE  180
NSSKKRRKKS KNRAAHSVSY SPEPFNADGT VRKCTHCETT KTPQWREGPS GPKTLCNACG  240
VRFRSGRLVP EYRPASSPTF IPTVHSNSHR KIIEMRRKDG DQFKTGRIYA VRSRA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183187KKRRK
2183188KKRRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934418e-62AB493441.1 Arabidopsis thaliana At1g08010 mRNA for hypothetical protein, partial cds, clone: RAAt1g08010.
GenBankAC0268758e-62AC026875.4 Genomic sequence for Arabidopsis thaliana BAC T6D22 from chromosome I, complete sequence.
GenBankAK2293668e-62AK229366.1 Arabidopsis thaliana mRNA for putative GATA transcription factor 3, complete cds, clone: RAFL16-61-D15.
GenBankBT0149748e-62BT014974.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankBT0157138e-62BT015713.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankCP0026848e-62CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409859.10.0hypothetical protein EUTSA_v10017012mg
SwissprotQ6DBP81e-117GAT11_ARATH; GATA transcription factor 11
TrEMBLV4M8B90.0V4M8B9_EUTSA; Uncharacterized protein
STRINGscaffold_401176.11e-146(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.11e-110GATA transcription factor 13